PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G01774.1.p
Common NameEUGRSUZ_G01774, LOC104453423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 256aa    MW: 28893.8 Da    PI: 7.885
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G01774.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.G01774.1.p 14 KGAWTKEEDDKLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding59.76.4e-1967111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T+eEde++++++ +lG++ W++Ia +++ gRt++++k++w+++
  Eucgr.G01774.1.p  67 RGNFTEEEDEIIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.601961IPR017930Myb domain
SMARTSM007177.7E-141363IPR001005SANT/Myb domain
SuperFamilySSF466891.11E-2913108IPR009057Homeodomain-like
PfamPF002493.7E-151461IPR001005SANT/Myb domain
CDDcd001671.65E-101661No hitNo description
PROSITE profilePS5129429.3162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2865116IPR009057Homeodomain-like
SMARTSM007179.2E-1866114IPR001005SANT/Myb domain
PfamPF002496.1E-1767111IPR001005SANT/Myb domain
CDDcd001671.06E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDKLIAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDEIIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLNRG  120
IDPATHRLIN EPAQDHHDEP TISFAANSKE IKEMKNNAEL NFMCNLEESA DVASSARERC  180
PDLNLELGIS PPSHQLHQPE PLLRFTGRKS DLCLECNLGL KNSQNCRCSV GVIESETSVG  240
YDFLGLKASV LDYRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G01774.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5760240.0AJ576024.1 Eucalyptus gunnii mRNA for MYB transcription factor (myb1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066271.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-114MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A059BDC20.0A0A059BDC2_EUCGR; Uncharacterized protein
TrEMBLI0IK110.0I0IK11_EUCGG; MYB transcription factor 1
STRINGPOPTR_0004s18020.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-104myb domain protein 4